Top Level Name

  ⌊ Superfamily (core) Haloacid Dehalogenase

    ⌊ Subgroup C1.6: Phosphoserine Phosphatase Like

  C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like

     ⌊ Family deoxy-d-mannose-octulosonate 8-phosphate phosphatase

  ⌊ FunctionalDomain deoxy-d-mannose-octulosonate 8-phosphate phosphatase (ID 22173)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IEA
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 724 491894424 WP_005657697.1 (RefSeq)
Haemophilus influenzae 3655 Taxon ID: 375177 144986200 EDJ92790.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A0H3PCI3 A0A0H3PCI3_HAEI3 (TrEMBL)

Sequence

Length of Enzyme (full-length): 180 | Length of Functional Domain: 172

1       10        20        30        40        50        60

MQQKLENIKFVITDVDGVLTDGQLHYDANGEALKSFHVRDGLGIKMLMDAGIQVAVLSGR
DSPILRRRIADLGIKLYFLGKLEKETACFELMKQAGVTAEQTAYIGDDSVDLPAFAACGT
SFAVADAPIYVKNAVDHVLSTNGGKGAFREMSDMILQAQGKSSVFDSAQGFL
KSVKNMGQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 1/2 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
58 Ser (S) side chain interacts with substrate/intermediate substrate binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
14 Asp (D) side chain Mg2+ ligand, nucleophile: attacks phosphate moiety of substrate to form covalent intermediate covalent catalysis -- reactant,
metal ligand -- binding
ISS PubMed:11835514
16 Asp (D) side chain Mg2+ ligand, general acid: donates proton to leaving group, general base: activates water metal ligand -- binding,
proton relay -- reactant
ICS PubMed:11835514
58 Ser (S) side chain binds phosphate moiety of substrate, positions water steric role -- spectator,
substrate binding -- binding
ICS PubMed:11835514
84 Lys (K) side chain positions nucleophilic Asp, binds phosphate moiety of substrate steric role -- spectator,
substrate binding -- binding
ICS PubMed:11835514
107 Asp (D) side chain Mg2+ ligand metal ligand -- binding ISS PubMed:11835514
111 Asp (D) side chain positions Lys steric role -- spectator ICS PubMed:11835514
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
14 Asp (D) side chain Mg2+ ligand, nucleophile: attacks phosphate moiety of substrate to form covalent intermediate covalent catalysis -- reactant,
metal ligand -- binding
ISS PubMed:11835514
16 Asp (D) side chain Mg2+ ligand, general acid: donates proton to leaving group, general base: activates water metal ligand -- binding,
proton relay -- reactant
ICS PubMed:11835514
58 Ser (S) side chain binds phosphate moiety of substrate, positions water steric role -- spectator,
substrate binding -- binding
ICS PubMed:11835514
84 Lys (K) side chain positions D28, binds phosphate moiety of substrate steric role -- spectator,
substrate binding -- binding
ICS PubMed:11835514
107 Asp (D) side chain Mg2+ ligand metal ligand -- binding ICS PubMed:11835514
111 Asp (D) side chain positions K98 steric role -- spectator ICS PubMed:11835514

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
1K1E Structure Of The Cobalt-Bound Form Of The Deoxy-D-Mannose-Octulosonate 8-Phosphate Phosphatase (Yrbi) From Haemophilus Influenzae (Hi1679) Deoxy-D-Mannose-Octulosonate 8-Phosphate Phosphatase 20 1.67 Cobalt (Ii) Ion
(4 more ⇓)
CSA • PDB • PDBSum
1J8D Structure Of The Metal-Free Form Of The Deoxy-D-Mannose-Octulosonate 8-Phosphate Phosphatase (Yrbi) From Haemophilus Influenzae (Hi1679) Deoxy-D-Mannose-Octulosonate 8-Phosphate Phosphatase 11 2.3 Selenomethionine • Glycerol CSA • PDB • PDBSum
4HGP Crystal Structure Of 2-Keto-3-Deoxyoctulosonate 8-Phosphate Phosphohydrolase From Haemophilus Influenzae In Complex With Transition State Mimic 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase Kdsc 20 1.8 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Nov. 3, 2014, 10:09 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.