Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ Family deoxy-d-mannose-octulosonate 8-phosphate phosphatase
⌊ FunctionalDomain deoxy-d-mannose-octulosonate 8-phosphate phosphatase (ID 22135)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Haemophilus influenzae 22.4-21 Taxon ID: 375063 | 145274230 | EDK14095.1 (Genbank) | URP |
| obsolete GIs = 145641069, 491916774 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A4NXS4 | A4NXS4_HAEIF (TrEMBL) |
Length of Enzyme (full-length): 180 | Length of Functional Domain: 172
MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGR
DSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGT
SFTVADAPIYVKNTVDHVLSTNGGKGAFREMSDMILQAQGKSSVFDSAQGFLKSVKNMGQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



