Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme (ID 2127733)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
Family Assignment Evidence Code | IEA |
This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia coli Taxon ID: 562 | 487521414 | WP_001708556.1 (RefSeq) | URP |
Escherichia coli 2866550 Taxon ID: 1116029 | 476159710 | EMV81282.1 (Genbank) | URP |
Length of Enzyme (full-length): 89 | Length of Functional Domain: 88
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.