Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup 7-carboxy-7-deazaguanine synthase like
⌊ Family 7-carboxy-7-deazaguanine synthase, Cx14CxxC type
⌊ FunctionalDomain uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence (ID 2113606)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Burkholderia ubonensis Taxon ID: 101571 | 497776135 | WP_010090319.1 (RefSeq) | URP |
Length of Enzyme (full-length): 210 | Length of Functional Domain: 210
MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQALCRFCDTDFVGTDGEN
GGKFKDAAALAAQVASLWPDGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS
LPVLESIDWICVSPKADVPLVVTKGNELKVVIPQDNQRLADYAKLDFDYFLVQPMDGPSR
DLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



