Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup glucarate dehydratase

     ⌊ Family glucarate dehydratase

  ⌊ FunctionalDomain glucarate dehydratase (ID 20971)

Superfamily Assignment Evidence Code(s) IEA
Family Assignment Evidence Code IEA
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Salmonella enterica Taxon ID: 28901 446133947 WP_000211802.1 (RefSeq) URP
Salmonella enterica subsp. enterica serovar Enteritidis str. 18569 Taxon ID: 696867 820759408 AKG76216.1 (Genbank) URP
Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100325 Taxon ID: 1412600 610431925 AHT94348.1 (Genbank) URP
Show All

Sequence

Length of Enzyme (full-length): 446 | Length of Functional Domain: 445

1       10        20        30        40        50        60

MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGVGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGQALNVPVCELLGPGKQRDAVTVLGYLFYIGDRTKTDLPYLESTPGSHEWYRLRHQE
ALNSDAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAIALCKGLKDVLTYAEYPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLTGAVCVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGK
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVRKAHDAYKKLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
234 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
259 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
288 Asn (N) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Lys (K) side chain abstracts alpha proton from l-stereochemistry substrates proton relay -- reactant ISS PubMed:10769114
234 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
259 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
288 Asn (N) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
312 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator ISS PubMed:10769114
338 His (H) side chain abstracts alpha proton from d-stereochemistry substates proton relay -- reactant ISS PubMed:10769114
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Lys (K) side chain abstracts alpha proton from l-idarate proton relay -- reactant IDA PubMed:11513584
234 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
259 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
288 Asn (N) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
312 Asp (D) side chain controls pKa of H385 perturbates pKa -- spectator ICS PubMed:10769114
338 His (H) side chain abstracts alpha proton from d-glucarate proton relay -- reactant IDA PubMed:11513584
340 Asn (N) side chain general acid (facilitates departure of 4-OH and stereospecific tautomerization) OR positions H339 to act as general acid proton relay -- reactant IDA PubMed:11513584

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4GYP Crystal Structure Of The Heterotetrameric Complex Of Glucd And Glucdrp From E. Coli K-12 Mg1655 Glucarate Dehydratase • Glucarate Dehydratase-Related Protein 791 2.1 Magnesium Ion
(5 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Nov. 3, 2014, 2:39 a.m. update curation agent updateSFLD2.py setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.