Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 2095357)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 446873964 | WP_000951220.1 (RefSeq) | URP |
| Escherichia coli Taxon ID: 562 | 823010082 | KLH32758.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3609 Taxon ID: 1446574 | 651674086 | KDV56303.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-3794 Taxon ID: 1446561 | 607819079 | EZE98133.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2009EL1302 Taxon ID: 1446558 | 607802714 | EZE82474.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2009C-4750 Taxon ID: 1446557 | 607790812 | EZE70963.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2009C-4050 Taxon ID: 1446555 | 607764788 | EZE45759.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. K5269 Taxon ID: 1446576 | 607565715 | EZC52975.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. K5198 Taxon ID: 1446575 | 607564418 | EZC51711.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. F6714 Taxon ID: 1446499 | 607403681 | EZA95381.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 03-3227 Taxon ID: 1446552 | 606981850 | EZA11635.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 06-3003 Taxon ID: 1446553 | 606952965 | EYZ84129.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 06-3822 Taxon ID: 1446554 | 606917112 | EYZ50472.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-4732 Taxon ID: 1446564 | 606853407 | EYY89688.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-4824 Taxon ID: 1446565 | 606824557 | EYY62698.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-4966 Taxon ID: 1446566 | 606813649 | EYY52528.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-4989 Taxon ID: 1446567 | 606797720 | EYY37345.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010EL1058 Taxon ID: 1446568 | 606792103 | EYY32048.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3108 Taxon ID: 1446570 | 606784615 | EYY24867.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3072 Taxon ID: 1446569 | 606783900 | EYY24175.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3216 Taxon ID: 1446571 | 606774649 | EYY15562.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3500 Taxon ID: 1446572 | 606762657 | EYY04254.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2011C-3537 Taxon ID: 1446573 | 606754620 | EYX96599.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2009C-4659 Taxon ID: 1446556 | 606529564 | EYV84052.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2009EL1412 Taxon ID: 1446559 | 606526477 | EYV81071.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-3609 Taxon ID: 1446560 | 606455681 | EYV13091.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-3840 Taxon ID: 1446562 | 606448844 | EYV06525.1 (Genbank) | URP |
| Escherichia coli O121:H19 str. 2010C-4254 Taxon ID: 1446563 | 606418801 | EYU78048.1 (Genbank) | URP |
| Escherichia coli ATCC BAA-2219 Taxon ID: 1405295 | 566112623 | ETI71566.1 (Genbank) | URP |
| Escherichia coli 5.0959 Taxon ID: 869684 | 386205882 | EII10388.1 (Genbank) | URP |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0E2TT63 | A0A0E2TT63_ECOLX (TrEMBL) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLETCMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



