Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 2092787)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 485790958 | WP_001412877.1 (RefSeq) | URP |
| Escherichia coli P0304777.3 Taxon ID: 1116165 | 477213311 | ENE88795.1 (Genbank) | URP |
| Escherichia coli P0304777.13 Taxon ID: 1116174 | 477194366 | ENE70453.1 (Genbank) | URP |
| Escherichia coli P0304777.11 Taxon ID: 1116172 | 477181959 | ENE58442.1 (Genbank) | URP |
| Escherichia coli p0305293.13 Taxon ID: 1116101 | 477070255 | END52095.1 (Genbank) | URP |
| Escherichia coli P0302308.4 Taxon ID: 1116156 | 477044401 | END28007.1 (Genbank) | URP |
| Escherichia coli BCE011_MS-01 Taxon ID: 1116114 | 476824606 | ENB24194.1 (Genbank) | URP |
| Escherichia coli BCE019_MS-13 Taxon ID: 1116115 | 476124171 | EMV46756.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQGQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



