Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme (ID 2079976)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 516010329 | WP_017440912.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Typhimurium Taxon ID: 90371 | 818423499 | AKG29831.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica Taxon ID: 59201 | 758748680 | KIV45991.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica Taxon ID: 59201 | 758747784 | KIV45098.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Agona str. 632182-2 Taxon ID: 1124919 | 554358127 | ESH95384.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 265 | Length of Functional Domain: 245
MSNLTDCITNESVAVTADKKPVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRD
TWDTHGGKEITVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIH
TCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLSKKN
VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDG
VKPPKKETMERVKDILEQYGHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



