Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup 7-carboxy-7-deazaguanine synthase like
⌊ Family 7-carboxy-7-deazaguanine synthase, Cx14CxxC type
⌊ FunctionalDomain uncharacterized 7-carboxy-7-deazaguanine synthase CX14CX2C-like sequence (ID 2012994)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 87882 | 493541511 | WP_006495383.1 (RefSeq) | |
| Burkholderia cepacia Taxon ID: 292 | 686815195 | KGB94679.1 (Genbank) | URP |
| Burkholderia cepacia Taxon ID: 292 | 685660780 | AIO47907.1 (Genbank) | URP |
| Burkholderia cenocepacia H111 Taxon ID: 1055524 | 590117657 | URP | |
| obsolete GI = 358074608 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A142PKC0 | A0A142PKC0_9BURK (TrEMBL) | |
| n/a | A0A095DRM0 | A0A095DRM0_BURCE (TrEMBL) |
Length of Enzyme (full-length): 210 | Length of Functional Domain: 210
MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAVCRFCDTDFVGTDGEN
GGKFKDAAALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFEIAIETNGS
LPVLESIDWICVSPKADAPLVVTKGNELKVVVPQDNQRLADYAKLDFEYFLVQPMDGPSR
DLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



