Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 2006426)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 555250345 | WP_023233886.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Cerro Taxon ID: 340188 | 856826515 | KMN29017.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro FSL R8-0235 Taxon ID: 1094506 | 627374127 | KCU91389.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. 5569 Taxon ID: 1173805 | 564581302 | ETC76189.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001588 Taxon ID: 1410916 | 564566479 | ETC62627.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001589 Taxon ID: 1410919 | 564561664 | ETC57864.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001670 Taxon ID: 1410922 | 564556304 | ETC52696.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001587 Taxon ID: 1410918 | 564548789 | ETC45433.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001673 Taxon ID: 1410924 | 564539676 | ETC36609.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001590 Taxon ID: 1410920 | 564528462 | ETC25587.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001679 Taxon ID: 1410925 | 564527251 | ETC24384.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001671 Taxon ID: 1410923 | 564525586 | ETC22733.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001697 Taxon ID: 1410931 | 564518020 | ETC15395.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001669 Taxon ID: 1410921 | 564514264 | ETC11678.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001692 Taxon ID: 1410930 | 564508049 | ETC05711.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001681 Taxon ID: 1410927 | 564504076 | ETC01781.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001674 Taxon ID: 1410917 | 564496198 | ETB94112.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001690 Taxon ID: 1410928 | 564492396 | ETB90391.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001680 Taxon ID: 1410926 | 564483504 | ETB81661.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. CFSAN001691 Taxon ID: 1410929 | 564476236 | ETB74517.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Cerro str. 818 Taxon ID: 1124928 | 554288027 | ESH23533.1 (Genbank) | URP |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | V7UKS6 | V7UKS6_SALET (TrEMBL) |
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MARHPRWTLSQVTELFEKPLLELLFEAQQIHRQHFDPLQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEKIVQGV
KAMGLETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
REAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDK
DLQLFRKLGLNPQQTRVLAGDNEQQQRLEQTLMTPDTDDYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



