Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup BATS domain containing
⌊ Family biotin synthase
⌊ FunctionalDomain biotin synthase-like protein (ID 2005844)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | ISS |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 693032987 | WP_032208107.1 (RefSeq) | URP |
| Escherichia coli Taxon ID: 562 | 822985733 | KLH09120.1 (Genbank) | URP |
| Escherichia coli Taxon ID: 562 | 730030032 | KHJ17833.1 (Genbank) | URP |
| Escherichia coli O165:H25 str. 2010C-4874 Taxon ID: 1446700 | 606809503 | EYY48513.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 346 | Length of Functional Domain: 323
MAHRPRWTLSQITELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC
PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV
KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DLQLFRKLGLNPQQTAVLAGDNEQQQRLEQALMTPDTDEYYNAAAL
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



