Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme (ID 1990469)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Klebsiella pneumoniae Taxon ID: 573 | 556247817 | WP_023286196.1 (RefSeq) | URP |
| Klebsiella pneumoniae Taxon ID: 573 | 839698363 | KMH72031.1 (Genbank) | URP |
| Klebsiella pneumoniae Taxon ID: 573 | 839598545 | KMG73106.1 (Genbank) | URP |
| Klebsiella pneumoniae MRSN 3852 Taxon ID: 1409964 | 816081181 | KKJ28774.1 (Genbank) | URP |
| Klebsiella pneumoniae MGH 21 Taxon ID: 1328366 | 555201086 | ESN43483.1 (Genbank) | URP |
| Klebsiella pneumoniae MGH 32 Taxon ID: 1328370 | 555153082 | ESM95736.1 (Genbank) | URP |
| Klebsiella pneumoniae BIDMC 23 Taxon ID: 1328418 | 555015736 | ESL60181.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 246 | Length of Functional Domain: 245
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHDGKEITVEELMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLAKKNINVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVHPPKKETMERVKGILEQY
GHKVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



