Top Level Name
⌊ Superfamily (core) Radical SAM
⌊ Subgroup organic radical-activating enzymes
⌊ Family pyruvate formate-lyase activase
⌊ FunctionalDomain Pyruvate formate-lyase-activating enzyme (ID 1947189)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
Family Assignment Evidence Code | IEA |
This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Enterobacteriaceae bacterium strain FGI 57 Taxon ID: 693444 | 506488644 | WP_015965105.1 (RefSeq) | URP |
Enterobacteriaceae bacterium strain FGI 57 Taxon ID: 693444 | 440047805 | AGB78863.1 (Genbank) | URP |
obsolete GI = 440288283 |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
n/a | L0M4P3 | L0M4P3_ENTBF (TrEMBL) |
Length of Enzyme (full-length): 246 | Length of Functional Domain: 245
MSVTGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEELMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDEL
LEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLSKKEINVWIRYVVVPGWSDDDDS
AHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVHPPKKETMERVKGILEQY
GHRVMY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.