Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup mannonate dehydratase

  ⌊ FunctionalDomain uncharacterized mannonate dehydratase subgroup sequence, enolase superfamily (ID 18480)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Chromohalobacter salexigens DSM 3043 Taxon ID: 290398 165761376 URP
Chromohalobacter salexigens DSM 3043 Taxon ID: 290398 165761375 URP
Chromohalobacter salexigens DSM 3043 Taxon ID: 290398 165761374 URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
D-galactonate dehydratase family member ManD Q1QT89 4.2.1.- DMGD_CHRSD (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 413 | Length of Functional Domain: 404

1       10        20        30        40        50        60

MSLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGR
DAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVM
TYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAKTPGERYEPADSSLPA
EHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLED
CVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRR
VADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRF
EDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
EGHHHHHH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
213 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
239 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
265 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 8/8 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
149 Arg (R) side chain controls pKa of catalytic Tyr perturbates pKa -- spectator ICS PubMed:17944491
161 Tyr (Y) side chain abstracts proton from C2 of substrate; may facilitate departure of 3-OH leaving group proton relay -- reactant ICS PubMed:17944491
213 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:17944491
215 His (H) side chain may facilitate departure of 3-OH leaving group increase electrophilicity -- spectator ICS PubMed:17944491
239 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:17944491
265 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:17944491
286 Arg (R) side chain electrophilic catalyst, stabilizes enolate anion intermediate covalent catalysis -- reactant,
electrostatic stabiliser -- spectator
ICS PubMed:17944491
342 Glu (E) side chain electrophilic catalyst, stabilizes enolate anion intermediate covalent catalysis -- reactant,
electrostatic stabiliser -- spectator
ICS PubMed:17944491

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3QKE Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg And D-Gluconate Mandelate Racemase/Muconate Lactonizing Enzyme 7 1.55 Gluconic Acid • Magnesium Ion CSA • PDB • PDBSum
3P93 Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg,D-Mannonate And 2-Keto-3-Deoxy-D-Gluconate Mandelate Racemase/Muconate Lactonizing Enzyme 7 1.8 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
3OW1 Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg Mandelate Racemase/Muconate Lactonizing Enzyme 7 1.8 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
3PK7 Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens With Mg And Glycerol Bound In The Active Site Mandelate Racemase/Muconate Lactonizing Enzyme 7 1.64 Magnesium Ion • Glycerol CSA • PDB • PDBSum
3RGT Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With D-Arabinohydroxamate D-Mannonate Dehydratase 7 1.9 Cobalt (Ii) Ion • (2S,3R,4R)-2,3,4,5-Tetrahydroxy-N-Oxo-Pentanamide CSA • PDB • PDBSum
3BSM Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Mandelate Racemase/Muconate Lactonizing Enzyme 7 2.2 CSA • PDB • PDBSum
4KWS Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg And Glycerol D-Mannonate Dehydratase 7 1.64 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
4KT2 Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg And Glycerol D-Mannonate Dehydratase 7 1.8 Chloride Ion
(3 more ⇓)
CSA • PDB • PDBSum
4KPL Crystal Structure Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg,D-Mannonate And 2-Keto-3-Deoxy-D-Gluconate D-Mannonate Dehydratase 7 2.0 D-Mannonic Acid
(4 more ⇓)
CSA • PDB • PDBSum
4K2S Crystal Structure Of The Mutant P317A Of D-Mannonate Dehydratase From Chromohalobacter Salexigens Complexed With Mg And D-Gluconate D-Mannonate Dehydratase 6 1.7 Yes Gluconic Acid
(3 more ⇓)
CSA • PDB • PDBSum
4F4R Crystal Structure Of D-Mannonate Dehydratase Homolog From Chromohalobacter Salexigens (Target Efi-502114), With Bound Na, Ordered Loop D-Mannonate Dehydratase 7 1.8 Sodium Ion
(2 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Nov. 3, 2014, 2:38 a.m. update curation agent updateSFLD2.py setDomainBoundaries.py
June 8, 2015, 3:11 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
remove family assignment evidence code IEA -
remove family mannonate dehydratase -
update name mannonate dehydratase uncharacterized mannonate dehydratase subgroup sequence, enolase superfamily
July 9, 2015, 3:13 a.m. update domain start position 3 2
EC number assigned by UniProtKB accession ID.