Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family L-talarate/galactarate dehydratase
⌊ FunctionalDomain L-talarate/galactarate dehydratase (ID 1748941)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 555261703 | WP_023243768.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica Taxon ID: 59201 | 735767543 | KHP37713.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica Taxon ID: 59201 | 735765495 | KHP35678.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000207 Taxon ID: 1173435 | 677862225 | KFT77027.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Anatum str. ATCC BAA-1592 Taxon ID: 984211 | 605523018 | AHW15632.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Anatum str. USDA 100 Taxon ID: 1124924 | 554369016 | ESJ05851.1 (Genbank) | URP |
| obsolete GI = 554368438 | |||
| Show All | |||
Length of Enzyme (full-length): 398 | Length of Functional Domain: 377
MALSANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEV
AIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGA
SVGRSGMAVQAISPIDIALWDMKSKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVL
KNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMG
RKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQP
DAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQ
LELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



