Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup glucarate dehydratase
⌊ Family glucarate dehydratase
⌊ FunctionalDomain glucarate dehydratase (ID 1748555)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 555258476 | WP_023241027.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000184 Taxon ID: 1173473 | 677949808 | KFU59384.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000187 Taxon ID: 1173475 | 677925730 | KFU36338.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000192 Taxon ID: 1173454 | 677919801 | KFU30972.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000195 Taxon ID: 1173476 | 677911720 | KFU23521.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000194 Taxon ID: 1173460 | 677908711 | KFU20627.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000196 Taxon ID: 1173430 | 677900916 | KFU13344.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000198 Taxon ID: 1173452 | 677899649 | KFU12127.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000195 Taxon ID: 1173476 | 677896879 | KFU09452.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000201 Taxon ID: 1173432 | 677892735 | KFU05598.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000199 Taxon ID: 1173431 | 677890958 | KFU03883.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000204 Taxon ID: 1173433 | 677887380 | KFU00433.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000202 Taxon ID: 1173477 | 677880366 | KFT93947.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000208 Taxon ID: 1173451 | 677871095 | KFT85236.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000206 Taxon ID: 1173458 | 677864026 | KFT78776.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000209 Taxon ID: 1173436 | 677854539 | KFT69856.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000214 Taxon ID: 1173439 | 677840364 | KFT56246.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000216 Taxon ID: 1173469 | 677834214 | KFT50479.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000218 Taxon ID: 1173455 | 677821352 | KFT38219.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000219 Taxon ID: 1173442 | 677809914 | KFT27359.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000222 Taxon ID: 1173420 | 677804941 | KFT22607.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000223 Taxon ID: 1173444 | 677793425 | KFT11942.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000225 Taxon ID: 1173446 | 677784815 | KFT04098.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000233 Taxon ID: 1173449 | 677766200 | KFS87693.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000203 Taxon ID: 1173453 | 646660936 | KDQ85600.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000183 Taxon ID: 1173463 | 554337856 | ESH75336.1 (Genbank) | URP |
| Show All | |||
Length of Enzyme (full-length): 446 | Length of Functional Domain: 446
MSTQFTTPVVTEMQVIPIAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTAVRNQFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDEQCDWYRLRHE
EAMTPETVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAKRFPQARVTLDPNGAW
SLNEAISIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGMVQVPTKPGLGVELDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



