Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup galactarate dehydratase

  ⌊ FunctionalDomain Uncharacterized Galactarate dehydratase subgroup sequence (ID 1559425)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank: obsolete GI = 516408668

Sequence

Length of Enzyme (full-length): 392 | Length of Functional Domain: 391

1       10        20        30        40        50        60

MMKITDLELHAVGIPRHTGFVNKHVIVRIHTDEGLTGIGEMSDFSHLPLYSVDLHDLKQG
LLSILLGKNPFDLMKINKELTDHFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDF
LGGRVKEKIKVCYPIFRHRFLEEVESNLDVVRQKLNQGFDVFRLYVGKNLDADEEFLSRV
KEEFGSRVRIKSYDFSHLLNWKDAHRAIKRLTKYDLGLEMIESPAPRNDFDGLYQLRLKT
DYPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGLTSAKKAAYAAEVASKDIVLGTTQE
LSVGTAAMAHLGCSLTNINHTSDPTGPELYVGDVVQNRVTYKDGYLYAPDRTVKGLGIEL
DESLLAKYQVPDLSWDNVSVHQLQDRTADTTS
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
194 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
222 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
246 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 9/9 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
43 Asp (D) side chain metal binding ligand (second metal) metal ligand -- binding ICS PubMed:19883118
46 His (H) side chain metal binding ligand (second metal) metal ligand -- binding ICS PubMed:19883118
91 Tyr (Y) side chain facilitates departure of beta-hydroxide leaving group; acid catalyst for ketonization of enol intermediate increase electrophilicity -- spectator,
proton relay -- reactant 		ICS PubMed:19883118
163 Arg (R) side chain controls pKa of Tyr perturbates pKa -- spectator ICS PubMed:19883118
165 Tyr (Y) side chain abstracts proton from C2 of galactarate proton relay -- reactant ICS PubMed:19883118
194 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:19883118
222 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:19883118
247 His (H) side chain metal binding ligand metal ligand -- binding ICS PubMed:19883118
298 Thr (T) side chain metal binding ligand (second metal) metal ligand -- binding ICS PubMed:19883118

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3GD6 Crystal Structure Of Divergent Enolase From Oceanobacillus Iheyensis Complexed With Phosphate Muconate Cycloisomerase 4 1.6 Phosphate Ion CSA • PDB • PDBSum
3FYY Crystal Structure Of Divergent Enolase From Oceanobacillus Iheyensis Complexed With Mg Muconate Cycloisomerase 4 1.8 Magnesium Ion CSA • PDB • PDBSum
3ES8 Crystal Structure Of Divergent Enolase From Oceanobacillus Iheyensis Complexed With Mg And L-Malate. Muconate Cycloisomerase 4 2.2 (2S)-2-Hydroxybutanedioic Acid • Magnesium Ion CSA • PDB • PDBSum
3ES7 Crystal Structure Of Divergent Enolase From Oceanobacillus Iheyensis Complexed With Mg And L-Malate. Muconate Cycloisomerase 4 1.9 (2S)-2-Hydroxybutanedioic Acid • Magnesium Ion CSA • PDB • PDBSum
2OQY The Crystal Structure Of Muconate Cycloisomerase From Oceanobacillus Iheyensis Muconate Cycloisomerase 4 2.0 Magnesium Ion CSA • PDB • PDBSum
3HPF Crystal Structure Of The Mutant Y90F Of Divergent Galactarate Dehydratase From Oceanobacillus Iheyensis Complexed With Mg And Galactarate Muconate Cycloisomerase 4 1.8 Yes D-Galactaric Acid • Magnesium Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 3:34 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
June 8, 2015, 3:51 a.m. update curation agent setDomainBoundaries.py sbrown
update name uncharacterized enolase superfamily sequence Uncharacterized Galactarate dehydratase subgroup sequence
June 8, 2015, 3:51 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.