Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ Family L-talarate/galactarate dehydratase
⌊ FunctionalDomain L-talarate/galactarate dehydratase (ID 1558899)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 543 | 547430349 | WP_022066149.1 (RefSeq) | |
| Klebsiella pneumoniae Taxon ID: 573 | 839757510 | KMI30487.1 (Genbank) | URP |
| Klebsiella pneumoniae Taxon ID: 573 | 839740838 | KMI14016.1 (Genbank) | URP |
| Klebsiella pneumoniae Taxon ID: 573 | 821216624 | KKY88781.1 (Genbank) | URP |
| Klebsiella pneumoniae MGH-80 Taxon ID: 1438801 | 636431989 | KDM08834.1 (Genbank) | URP |
| Klebsiella pneumoniae MGH-68 Taxon ID: 1438791 | 636383719 | KDL60948.1 (Genbank) | URP |
| Klebsiella variicola Taxon ID: 244366 | 748581306 | URP | |
| Klebsiella variicola CAG:634 Taxon ID: 1263083 | 524235865 | URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0B7G9H5 | A0A0B7G9H5_KLEVA (TrEMBL) | |
| n/a | A0A0J4W164 | A0A0J4W164_KLEPN (TrEMBL) |
Length of Enzyme (full-length): 398 | Length of Functional Domain: 377
MTSSANSESVTYAKAFGVKTAAETGDRIDHVKLSLAFLPLATPVSDAKVLTGRQKPLTEV
AIIIAEIHSRDGFTGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGA
SVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGSHRDSVQCYNTSGGFLHTPLDQVL
KNVAISRENGIGGIKLKVGQPNTAEDIRRLTAVREVLGDDFPLMVDANQQWDRETAIRMG
RKMEPFNLIWIEEPLDAYDVEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQP
DAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLAAAYPLEPWLEHFEWLNPLFNEQ
LELRDGRMWVSERHGLGFTLSEQARRWTQQSCEFGKRP
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



