Top Level Name
⌊ Superfamily (core) Isoprenoid Synthase Type I
⌊ Subgroup Squalene/Phytoene Synthase Like
⌊ FunctionalDomain uncharacterized Squalene/phytoene Synthase Like subgroup sequence, Isoprenoid Synthase Type I superfamily (ID 1446201)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus Taxon ID: 1280 | 446100446 | WP_000178301.1 (RefSeq) | URP |
| Staphylococcus aureus subsp. aureus SA268 Taxon ID: 1368166 | 670941090 | AII57045.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21321 Taxon ID: 904765 | 645297550 | KDP62349.1 (Genbank) | URP |
| Staphylococcus aureus VET1518S Taxon ID: 1422794 | 616902508 | KAG94313.1 (Genbank) | URP |
| Staphylococcus aureus T63898 Taxon ID: 1418424 | 600323069 | EYM22926.1 (Genbank) | URP |
| Staphylococcus aureus T63897 Taxon ID: 1418423 | 600318115 | EYM18062.1 (Genbank) | URP |
| Staphylococcus aureus M64056 Taxon ID: 1418408 | 600292575 | EYL93113.1 (Genbank) | URP |
| Staphylococcus aureus M17033 Taxon ID: 1418319 | 600101809 | EYK06078.1 (Genbank) | URP |
| Staphylococcus aureus W25799 Taxon ID: 1421908 | 599818024 | EYH43212.1 (Genbank) | URP |
| Staphylococcus aureus F19490 Taxon ID: 1417137 | 599591069 | EYF22731.1 (Genbank) | URP |
| Staphylococcus aureus W25797 Taxon ID: 1421907 | 593347983 | EXP39651.1 (Genbank) | URP |
| Staphylococcus aureus W73738 Taxon ID: 1417213 | 587542082 | EWY21478.1 (Genbank) | URP |
| Staphylococcus aureus H81433 Taxon ID: 1417121 | 587423103 | EWX03858.1 (Genbank) | URP |
| Staphylococcus aureus F77917 Taxon ID: 1412637 | 585045793 | EWL68531.1 (Genbank) | URP |
| Staphylococcus aureus W21932 Taxon ID: 1411587 | 582845060 | EWB31189.1 (Genbank) | URP |
| Staphylococcus aureus H48054 Taxon ID: 1410907 | 582628727 | EVZ18779.1 (Genbank) | URP |
| Staphylococcus aureus H48052 Taxon ID: 1410906 | 582625936 | EVZ16005.1 (Genbank) | URP |
| Staphylococcus aureus F77047 Taxon ID: 1410832 | 582474078 | EVX67140.1 (Genbank) | URP |
| Staphylococcus aureus F70893 Taxon ID: 1410823 | 582451478 | EVX44980.1 (Genbank) | URP |
| Staphylococcus aureus OCMM6095 Taxon ID: 1409656 | 580786481 | EVI08709.1 (Genbank) | URP |
| Staphylococcus aureus OCMM6066 Taxon ID: 1409590 | 580638447 | EVG62086.1 (Genbank) | URP |
| Staphylococcus aureus OCMM6067 Taxon ID: 1409589 | 580635824 | EVG59513.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus SA40 Taxon ID: 1194085 | 545585275 | AGW37356.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus SA957 Taxon ID: 1201010 | 545582808 | AGW34890.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus IS-160 Taxon ID: 904786 | 375369413 | EHS73293.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus M013 Taxon ID: 1118959 | 359831549 | AEV79527.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21235 Taxon ID: 904738 | 341841235 | EGS82697.1 (Genbank) | URP |
| obsolete GIs = 545638779, 545635919, 379022240 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A181DK15 | A0A181DK15_STAAU (TrEMBL) |
Length of Enzyme (full-length): 287 | Length of Functional Domain: 287
MTMMAMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



