Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup muconate cycloisomerase

     ⌊ Family muconate cycloisomerase (anti)

  ⌊ FunctionalDomain muconate cycloisomerase (anti) (ID 14066)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IGS
This entry was last updated onNov. 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Mycobacterium smegmatis Taxon ID: 1772 500047284 WP_011728002.1 (RefSeq) URP
Mycobacterium smegmatis str. MC2 155 Taxon ID: 246196 118470554 YP_886276.1 (RefSeq) URP
Mycobacterium smegmatis Taxon ID: 1772 698957846 AIU20381.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0QTN8 A0QTN8_MYCS2 (TrEMBL)
n/a I7FZ22 I7FZ22_MYCS2 (TrEMBL)

Sequence

Length of Enzyme (full-length): 367 | Length of Functional Domain: 367

1       10        20        30        40        50        60

MKIVAIGAIPFSIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPPRPFTYGETQT
GIVAVIEQYFAPALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQSLRLSVSE
MLGGYTDRMRVSHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRALRE
RFGDAIELYVDGNRGWSAAESLRAMREMADLDLLFAEELCPADDVLSRRRLVGQLDMPFI
ADESVPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDMVMGNQIDGQIG
TACTVSFGTAFERTSRHAGELSNFLDMSDDLLTVPLQISDGQLHRRPGPGLGIEIDPDKL
AHYRTDN
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
191 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
217 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
242 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
162 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:11747448
191 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
217 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
242 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:11747448
Family CAR This EFD conserves 6/6 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
162 Lys (K) side chain abstracts alpha proton (base) proton relay -- reactant ICS PubMed:19220063
191 Asp (D) side chain metal ligand metal ligand -- binding ICS PubMed:19220063
217 Glu (E) side chain metal ligand metal ligand -- binding ICS PubMed:19220063
242 Asp (D) side chain metal ligand metal ligand -- binding ICS PubMed:19220063
266 Lys (K) side chain stabilizes intermediate electrostatic stabiliser -- spectator ICS PubMed:19220063
294 Gln (Q) side chain hydrogen bond donors to the lactone carbonyl of (4S)-muconolactone electrostatic stabiliser -- spectator ICS PubMed:19220063

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3DG6 Crystal Structure Of Muconate Lactonizing Enzyme From Mucobacterium Smegmatis Complexed With Muconolactone Muconate Cycloisomerase 3 1.6 Magnesium Ion • [(2S)-5-Oxo-2,5-Dihydrofuran-2-Yl]Acetic Acid CSA • PDB • PDBSum
3DG7 Crystal Structure Of Muconate Lactonizing Enzyme From Mucobacterium Smegmatis Complexed With Muconolactone Muconate Cycloisomerase 3 2.0 Magnesium Ion • [(2S)-5-Oxo-2,5-Dihydrofuran-2-Yl]Acetic Acid CSA • PDB • PDBSum
3DG3 Crystal Structure Of Muconate Lactonizing Enzyme From Mucobacterium Smegmatis Muconate Cycloisomerase 3 1.6 Magnesium Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Nov. 3, 2014, 2:35 a.m. update curation agent sbrown setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.