Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup glucarate dehydratase
⌊ Family glucarate dehydratase
⌊ FunctionalDomain glucarate dehydratase (ID 1398599)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Salmonella enterica Taxon ID: 28901 | 446029253 | WP_000107108.1 (RefSeq) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum str. AB198 Taxon ID: 1331043 | 575531810 | ETX32387.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. 19945 Taxon ID: 1079470 | 554167107 | ESG06634.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. 13036 Taxon ID: 1079471 | 553444357 | ESB69327.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum/Pullorum str. CDC1983-67 Taxon ID: 1225522 | 537375097 | AGU65740.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. S06004 Taxon ID: 1298917 | 529192267 | AGS64016.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum str. ATCC 9120 Taxon ID: 1029979 | 434938985 | ELL45875.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 Taxon ID: 1081093 | 357207198 | AET55244.1 (Genbank) | URP |
| Salmonella enterica subsp. enterica serovar Pullorum Taxon ID: 605 | 661553690 | URP | |
| obsolete GIs = 537438151, 529220824, 378956587 | |||
| Show All | |||
Length of Enzyme (full-length): 446 | Length of Functional Domain: 446
MSTQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTAVRNQFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQCSEVEMLGYLFFVGNRKATPLPYQSQPDEQCDWYRLRHE
EAMTPETVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAKRFPQARVTLDPNGAW
SLNEAISIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGMVQVPTKPGLGVELDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



