Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup glucarate dehydratase
⌊ Family glucarate dehydratase
⌊ FunctionalDomain glucarate dehydratase (ID 1397630)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 21, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Klebsiella oxytoca Taxon ID: 571 | 503992606 | WP_014226600.1 (RefSeq) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 846735428 | KMK46615.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 838852854 | KLY34808.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 834122358 | KLU49370.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 834116398 | KLU43582.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 828961057 | AKL34726.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 721576370 | KGZ19669.1 (Genbank) | URP |
| Klebsiella oxytoca Taxon ID: 571 | 668907417 | KFC41021.1 (Genbank) | URP |
| Klebsiella oxytoca KONIH1 Taxon ID: 1333852 | 660572041 | AID91961.1 (Genbank) | URP |
| Klebsiella oxytoca HKOPL1 Taxon ID: 1308980 | 612157750 | AHW87239.1 (Genbank) | URP |
| Klebsiella oxytoca MGH 41 Taxon ID: 1328430 | 583702552 | EWF64716.1 (Genbank) | URP |
| Klebsiella oxytoca E718 Taxon ID: 1191061 | 394347805 | AFN33926.1 (Genbank) | URP |
| Klebsiella oxytoca KCTC 1686 Taxon ID: 1006551 | 365906527 | AEX01980.1 (Genbank) | URP |
| obsolete GIs = 397659671, 375257049 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A0G3S390 | A0A0G3S390_KLEOX (TrEMBL) | |
| n/a | A0A0J2KP38 | A0A0J2KP38_9ENTR (TrEMBL) | |
| n/a | A0A0H3GXS7 | A0A0H3GXS7_KLEOK (TrEMBL) | |
| n/a | A0A1F2H5S0 | A0A1F2H5S0_9GAMM (TrEMBL) | |
| n/a | A0A068HJD7 | A0A068HJD7_KLEOX (TrEMBL) | |
| Show All | |||
Length of Enzyme (full-length): 446 | Length of Functional Domain: 446
MSAQFSTPVVSSMQVIPVAGHDSMLMNLSGAHAPFFTRNIVVIKDNSGHTGVGEIPGGEK
IRTTLEDAIPLVVGKTLGEYKNVLTAVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDDKCDWYRLRHD
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAKRFPQARVTLDPNGAW
SLDEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGMVQVPAKPGLGVELDMDRVMKAHELYQKHGLG
ARDDAMGMQYLIPNWTFDNKRPCMVR
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



