Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup glucarate dehydratase
⌊ Family glucarate dehydratase
⌊ FunctionalDomain glucarate dehydratase (ID 1397310)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli 2730450 Taxon ID: 1116006 | 476775372 | ENA77701.1 (Genbank) | URP |
| obsolete GI = 485770649 | |||
Length of Enzyme (full-length): 365 | Length of Functional Domain: 364
MVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALLDLLGKALNVPVCELLGPGKQR
EAITVLGYLFYIGDRTKTDLPYVENTPGNHEWYQLRHQKAMNSEAVVRLAEASQDRYGFK
DFKLKGGVLPGEQEIDTVRALKKRFPDARITADPNGAWLLDEAISLCKGLNDVLTYAEDP
CGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGA
VRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGNPTAIDTHWIWQEGDCRLTQNP
LEIKNGKIAVPDAPGLGVELDWEQVKKAHEAYKRLPGGARNDAGPMQYLISGWTFDRKRP
VFGRH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



