Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type I

    ⌊ Subgroup Squalene/Phytoene Synthase Like

  ⌊ FunctionalDomain uncharacterized Squalene/phytoene Synthase Like subgroup sequence (ID 136413)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 22, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Homo sapiens Taxon ID: 9606 193786634 PRP URP

Uniprot

Protein NameAccessionEC Number Identifier
Squalene synthase P37268 2.5.1.21 FDFT_HUMAN (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 306 | Length of Functional Domain: 259

1       10        20        30        40        50        60

MESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKY
CHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFW
PQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAI
PQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPD
SDPSSSKTRQIISTIRTQN
LPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDY
VQTGEH
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 1/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
104 Asn (N) side chain None --
Subgroup CAR This EFD conserves 4/7 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
60 Tyr (Y) side chain facilitates removal of Mg2+ PPi product complex formed in both half-reactions increase electrophilicity -- spectator IME PubMed:21098670
104 Asn (N) side chain Metal ligand metal ligand -- binding ICS
108 Asp (D) side chain Metal ligand metal ligand -- binding ICS
112 Asp (D) side chain None -- IME PubMed:21098670

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
3Q2Z Human Squalene Synthase In Complex With N-[(3R,5S)-7-Chloro-5-(2,3-Dimethoxyphenyl)-1-Neopentyl-2-Oxo-1,2,3,5-Tetrahydro-4,1-Benzoxazepine-3-Acetyl]-L-Aspartic Acid Squalene Synthase 37 2.0 Phosphate Ion • N-{[(3R,5S)-7-Chloro-5-(2,3-Dimethoxyphenyl)-1-(2,2-Dimethylpropyl)-2-Oxo-1,2,3,5-Tetrahydro-4,1-Benzoxazepin-3-Yl]Acetyl}-L-Aspartic Acid CSA • PDB • PDBSum
3Q30 Human Squalene Synthase In Complex With (2R,3R)-2-Carboxymethoxy-3-[5-(2-Naphthalenyl)Pentyl]Aminocarbonyl-3-[5-(2-Naphthalenyl) Pentyloxy]Propionic Acid Squalene Synthase 37 2.0 Magnesium Ion
(2 more ⇓)
CSA • PDB • PDBSum
3ASX Human Squalene Synthase In Complex With 1-{4-[{4-Chloro-2-[(2-Chlorophenyl)(Hydroxy)Methyl]Phenyl}(2,2-Dimethylpropyl)Amino]-4-Oxobutanoyl}Piperidine-3-Carboxylic Acid Squalene Synthase 37 2.0 Phosphate Ion • (3R)-1-{4-[{4-Chloro-2-[(S)-(2-Chlorophenyl)(Hydroxy) Methyl]Phenyl}(2,2-Dimethylpropyl)Amino]-4-Oxobutanoyl}Piperidine-3-Carboxylic Acid CSA • PDB • PDBSum
3LEE Crystal Structure Of The Human Squalene Synthase Complexed With Bph-652 Squalene Synthetase 37 3.2 (1R)-4-(3-Phenoxyphenyl)-1-Phosphonobutane-1-Sulfonic Acid • Magnesium Ion CSA • PDB • PDBSum
3VJ9 Crystal Structure Of The Human Squalene Synthase Squalene Synthase 37 1.52 Calcium Ion • Nickel (Ii) Ion CSA • PDB • PDBSum
3VJ8 Crystal Structure Of The Human Squalene Synthase Squalene Synthase 37 1.52 CSA • PDB • PDBSum
3VJC Crystal Structure Of The Human Squalene Synthase In Complex With Zaragozic Acid A Squalene Synthase 37 1.89 Zaragozic Acid A
(2 more ⇓)
CSA • PDB • PDBSum
3VJB Crystal Structure Of The Human Squalene Synthase Squalene Synthase 37 2.05 CSA • PDB • PDBSum
3VJA Crystal Structure Of The Human Squalene Synthase Squalene Synthase 37 1.76 Nickel (Ii) Ion CSA • PDB • PDBSum
1EZF Crystal Structure Of Human Squalene Synthase Farnesyl-Diphosphate Farnesyltransferase 37 2.15 Yes N-{2-[Trans-7-Chloro-1-(2,2-Dimethyl-Propyl) -5-Naphthalen-1-Yl-2-Oxo-1,2,3,5-Tetrahydro-Benzo[E] [1, 4]Oxazepin-3-Yl]-Acetyl}-Aspartic Acid CSA • PDB • PDBSum
3V66 Human Squalene Synthase In Complex With 2-(1-{2-[(4R,6S)-8-Chloro-6-(2,3-Dimethoxyphenyl)-4H,6H-Pyrrolo[1,2-A][4,1]Benzoxazepin-4-Yl]Acetyl}-4-Piperidinyl)Acetic Acid Squalene Synthase 37 1.8 Phosphate Ion • (1-{[(4R,6S)-8-Chloro-6-(2,3-Dimethoxyphenyl)-4H,6H-Pyrrolo[1,2-A][4,1]Benzoxazepin-4-Yl]Acetyl}Piperidin-4-Yl)Acetic Acid CSA • PDB • PDBSum
3WEI Crystal Structure Of The Human Squalene Synthase Y73A Mutant In Complex With Presqualene Pyrophosphate Squalene Synthase 37 1.79 Yes Manganese (Ii) Ion • {(1R,2R,3R)-2-[(3E)-4,8-Dimethylnona-3,7-Dien-1-Yl]-2-Methyl-3-[(1E,5E)-2,6,10-Trimethylundeca-1,5,9-Trien-1-Yl]Cyclopropyl}Methyl Trihydrogen Diphosphate CSA • PDB • PDBSum
3WEH Crystal Structure Of The Human Squalene Synthase In Complex With Presqualene Pyrophosphate Squalene Synthase 37 1.87 Magnesium Ion • {(1R,2R,3R)-2-[(3E)-4,8-Dimethylnona-3,7-Dien-1-Yl]-2-Methyl-3-[(1E,5E)-2,6,10-Trimethylundeca-1,5,9-Trien-1-Yl]Cyclopropyl}Methyl Trihydrogen Diphosphate CSA • PDB • PDBSum
3WEG Crystal Structure Of The Human Squalene Synthase In Complex With Farnesyl Thiopyrophosphate And Magnesium Ion Squalene Synthase 37 1.75 Magnesium Ion • S-[(2E,6E)-3,7,11-Trimethyldodeca-2,6,10-Trienyl] Trihydrogen Thiodiphosphate CSA • PDB • PDBSum
3WEF Crystal Structure Of The Human Squalene Synthase In Complex With Farnesyl Thiopyrophosphate Squalene Synthase 37 2.35 S-[(2E,6E)-3,7,11-Trimethyldodeca-2,6,10-Trienyl] Trihydrogen Thiodiphosphate CSA • PDB • PDBSum
3WEK Crystal Structure Of The Human Squalene Synthase F288L Mutant In Complex With Presqualene Pyrophosphate Squalene Synthase 37 1.85 Yes Magnesium Ion • {(1R,2R,3R)-2-[(3E)-4,8-Dimethylnona-3,7-Dien-1-Yl]-2-Methyl-3-[(1E,5E)-2,6,10-Trimethylundeca-1,5,9-Trien-1-Yl]Cyclopropyl}Methyl Trihydrogen Diphosphate CSA • PDB • PDBSum
3WEJ Crystal Structure Of The Human Squalene Synthase F288A Mutant In Complex With Presqualene Pyrophosphate Squalene Synthase 37 2.0 Yes Magnesium Ion • {(1R,2R,3R)-2-[(3E)-4,8-Dimethylnona-3,7-Dien-1-Yl]-2-Methyl-3-[(1E,5E)-2,6,10-Trimethylundeca-1,5,9-Trien-1-Yl]Cyclopropyl}Methyl Trihydrogen Diphosphate CSA • PDB • PDBSum
3WCM The Complex Structure Of Hssqs Wtih Ligand, Er119884 Squalene Synthase 23 2.06 Yes (3R)-3-{[2-Benzyl-6-(3-Methoxypropoxy)Pyridin-3-Yl]Ethynyl}-1-Azabicyclo[2.2.2]Octan-3-Ol CSA • PDB • PDBSum
3WCL The Complex Structure Of Hssqs Wtih Ligand,Bph1344 Squalene Synthase 23 2.24 Yes Hydrogen [(1R)-2-(3-Pentadecyl-1H-Imidazol-3-Ium-1-Yl)-1-Phosphonoethyl]Phosphonate CSA • PDB • PDBSum
3WCJ The Complex Structure Of Hssqs Wtih Ligand,E5700 Squalene Synthase 23 2.2 Yes (3R)-3-({2-Benzyl-6-[(3R,4S)-3-Hydroxy-4-Methoxypyrrolidin-1-Yl]Pyridin-3-Yl}Ethynyl)-1-Azabicyclo[2.2.2]Octan-3-Ol CSA • PDB • PDBSum
3WCI The Complex Structure Of Hssqs Wtih Ligand,Bph1325 Squalene Synthase 23 2.3 Yes Hydrogen [(1R)-1-Hydroxy-2-(3-Pentadecyl-1H-Imidazol-3-Ium-1-Yl)-1-Phosphonoethyl]Phosphonate CSA • PDB • PDBSum
3WCH The Complex Structure Of Hssqs Wtih Ligand Bph1237 Squalene Synthase 23 2.5 Yes Hydrogen [(1R)-2-(3-Decyl-1H-Imidazol-3-Ium-1-Yl)-1-Hydroxy-1-Phosphonoethyl]Phosphonate CSA • PDB • PDBSum
3WCF The Complex Structure Of Hssqs Wtih Ligand,Bph1218 Squalene Synthase 23 2.22 Yes Hydrogen [(1S)-2-(3-Decyl-1H-Imidazol-3-Ium-1-Yl)-1-Phosphonoethyl]Phosphonate CSA • PDB • PDBSum
3WCD The Complex Structure Of Hssqs Wtih Ligand, Wc-9 Squalene Synthase 23 2.75 Yes 2-(4-Phenoxyphenoxy)Ethyl Thiocyanate CSA • PDB • PDBSum
3WC9 The Complex Structure Of Hssqs Wtih Ligand, Fspp Squalene Synthase 23 2.82 Yes S-[(2E,6E)-3,7,11-Trimethyldodeca-2,6,10-Trienyl] Trihydrogen Thiodiphosphate CSA • PDB • PDBSum
3WSA The Tuberculosis Drug Sq109 Inhibits Trypanosoma Cruzi Cell Proliferation And Acts Synergistically With Posaconazole Squalene Synthase 23 2.9 Yes N-[(2Z)-3,7-Dimethylocta-2,6-Dien-1-Yl]-N'-[(1R,3S,5R, 7R)-Tricyclo[3.3.1.1~3,7~]Dec-2-Yl]Ethane-1,2-Diamine CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History

Time Change Annotation Old Value New Value
Aug. 2, 2014, 11:19 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
EC number assigned by UniProtKB accession ID.