Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type I

    ⌊ Subgroup Squalene/Phytoene Synthase Like

  ⌊ Phytoene synthase like

  ⌊ FunctionalDomain uncharacterized Phytoene synthase like subgroup sequence, Isoprenoid Synthase Type I superfamily (ID 134847)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Alicyclobacillus acidocaldarius Taxon ID: 405212 495612688 WP_008337267.1 (RefSeq)
Alicyclobacillus acidocaldarius LAA1 Taxon ID: 543302 218241056 EED08232.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a B7DNH2 B7DNH2_9BACL (TrEMBL)

Sequence

Length of Enzyme (full-length): 291 | Length of Functional Domain: 280

1       10        20        30        40        50        60

MGSVPVELRGDFEVCRQLTRSHYENFSVVSLFVPRHLRPHFYSVYAFCRGVDDLGDEYAG
DRMAALDAYEEELRRAFAGEATTPAFRALQFTIATCNLPMEPFLRLIEANRRDQRQHTYD
TWEDLRDYCRYSADPVGRLVLGIFGCLDDERARLSDATCTALQVANHMQDIDRDLALGRI
YVPRADLEQFGATLDDIRARRATDGVRRCIALEVDRAQALFDEGRRLESLVPPRLARQLK
LYRLGGEAILAAIRRQGYNPFAGRPVVSSKQKLRIALSVLAGGAKGEGGSA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 1/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
166 Asn (N) side chain None --
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
49 Arg (R) side chain None -- ISS
52 Asp (D) side chain None -- ISS
56 Asp (D) side chain None -- ISS
128 Tyr (Y) side chain facilitates removal of Mg2+ PPi product complex formed in both half-reactions increase electrophilicity -- spectator ISS
170 Asp (D) side chain None -- ISS
174 Asp (D) side chain None -- ISS

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4HD1 Crystal Structure Of Squalene Synthase Hpnc From Alicyclobacillus Acidocaldarius Squalene Synthase Hpnc 3 2.4 Selenomethionine • Sulfate Ion CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
April 30, 2014, 11:57 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 218 289
update domain start position 10 8
Feb. 13, 2017, 2:42 a.m. update domain end position 289 287
EC number assigned by UniProtKB accession ID.