Top Level Name
⌊ Superfamily (core) Isoprenoid Synthase Type I
⌊ Subgroup Squalene/Phytoene Synthase Like
⌊ FunctionalDomain uncharacterized Squalene/phytoene Synthase Like subgroup sequence (ID 133729)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Staphylococcus aureus Taxon ID: 1280 | 446100447 | WP_000178302.1 (RefSeq) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 827233152 | KLM23567.1 (Genbank) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 760466014 | AJP20989.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21251 Taxon ID: 904742 | 645292616 | KDP57691.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus Taxon ID: 46170 | 636563693 | AIA00378.1 (Genbank) | URP |
| Staphylococcus aureus M1242 Taxon ID: 1402739 | 586113331 | EWP20516.1 (Genbank) | URP |
| Staphylococcus aureus W33563 Taxon ID: 1412801 | 584720425 | EWI47395.1 (Genbank) | URP |
| Staphylococcus aureus W85432 Taxon ID: 1411600 | 582880500 | EWB65803.1 (Genbank) | URP |
| Staphylococcus aureus MUM270 Taxon ID: 1435481 | 570302311 | ETO57115.1 (Genbank) | URP |
| Staphylococcus aureus M1228 Taxon ID: 1303785 | 476601083 | EMZ08789.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus IS-105 Taxon ID: 904781 | 375037670 | EHS30688.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus 21310 Taxon ID: 904760 | 334274041 | EGL92371.1 (Genbank) | URP |
| Staphylococcus aureus subsp. aureus ED133 Taxon ID: 685039 | 298695824 | ADI99046.1 (Genbank) | URP |
| Staphylococcus aureus Taxon ID: 1280 | 811091276 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 811074772 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 811001541 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 810990798 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 810985283 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 810968816 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 808446480 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 805236456 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 805224347 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 803144500 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 803093550 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 803070457 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 803037798 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 802890494 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 802842964 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 802805241 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 801978579 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800874036 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800865808 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800863215 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800850874 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800842036 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800833640 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800828070 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800825774 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800823359 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800814418 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800806107 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800797681 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800795830 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800792336 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800789597 | URP | |
| Staphylococcus aureus Taxon ID: 1280 | 800329431 | URP | |
| Staphylococcus aureus subsp. aureus HO 5096 0412 Taxon ID: 1074252 | 385197522 | URP | |
| obsolete GIs = 418655229, 417799353, 386832130, 384548776 | |||
| Show All | |||
Length of Enzyme (full-length): 287 | Length of Functional Domain: 287
MTMMAMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQQFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



