Top Level Name
⌊ Superfamily (core) Isoprenoid Synthase Type I
⌊ Subgroup Squalene/Phytoene Synthase Like
⌊ FunctionalDomain uncharacterized Phytoene synthase like subgroup sequence, Isoprenoid Synthase Type I superfamily (ID 131711)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | June 10, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Alicyclobacillus acidocaldarius Taxon ID: 405212 | 502518817 | WP_012811689.1 (RefSeq) | |
| Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 Taxon ID: 521098 | 257479129 | ACV59448.1 (Genbank) | URP |
| obsolete GI = 258512403 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | C8WSG3 | C8WSG3_ALIAD (TrEMBL) |
Length of Enzyme (full-length): 291 | Length of Functional Domain: 280
MGSVPVELRGDFEVCRRLTRSHYENFSVVSLFVPRHLRPHFYSVYAFCRGVDDLGDEFAG
DRMAALDAYEEELRRAFAGEATTPAFRALQFTIATCNLPMEPFLRLIEANRRDQRKHTYD
TWEDLRDYCRYSADPVGRLVLGIFGCLDDERARLSDATCTALQVANHMQDIDRDLALGRI
YVPRADLEQFGATLDDIRARRATDGVRRCIALEVDRAQALFDEGRRLESLVPPRLARQLK
LYRLGGEAILAAIRRQGYNPFAGRPVVSGKQKLRIALSVLAGGAKGEGGSA
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



