Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.1: Epoxide Hydrolase Phosphatase Like
⌊ FunctionalDomain C1.5.1: Epoxide Hydrolase Phosphatase Like (ID 129999)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Feb. 13, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli 3431 Taxon ID: 670892 | 315618747 | EFU99331.1 (Genbank) | URP |
| obsolete GIs = 415773721, 485707766 | |||
Length of Enzyme (full-length): 190 | Length of Functional Domain: 190
MIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPL
SYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAAD
HIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTT
IPDYFAKVLC
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



