Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 124417)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Taxon ID: 561 | 446028971 | WP_000106826.1 (RefSeq) | |
| Escherichia coli TW10509 Taxon ID: 656449 | 323978091 | EGB73177.1 (Genbank) | URP |
| obsolete GIs = 458806817, 422781373 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1Q6BGH1 | A0A1Q6BGH1_ECOLX (TrEMBL) | |
| n/a | E9XJB9 | E9XJB9_ECOLX (TrEMBL) |
Length of Enzyme (full-length): 222 | Length of Functional Domain: 216
MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDL
WYARQPWNGPSRQEVVERVIARAISLVEETHPLLPGVREAVALCKEQGLLVGLASASPLH
MLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIA
SKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



