Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.6: Phosphoserine Phosphatase Like
⌊ C1.6.2: Deoxy-d-mannose-octulosonate 8-phosphate Phosphatase Like
⌊ Family deoxy-d-mannose-octulosonate 8-phosphate phosphatase
⌊ FunctionalDomain deoxy-d-mannose-octulosonate 8-phosphate phosphatase (ID 122956)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| Family Assignment Evidence Code | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Haemophilus influenzae Taxon ID: 727 | 503291033 | WP_013525694.1 (RefSeq) | URP |
| Haemophilus influenzae CGSHiCZ412602 Taxon ID: 1295140 | 646230067 | AIB45628.1 (Genbank) | URP |
| Haemophilus influenzae F3047 Taxon ID: 935897 | 317450667 | URP | |
| Haemophilus influenzae F3031 Taxon ID: 866630 | 317432389 | URP | |
| obsolete GIs = 319896885, 319776076 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | E7A3X1 | E7A3X1_HAEIF (TrEMBL) |
Length of Enzyme (full-length): 180 | Length of Functional Domain: 172
MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDAGIQVAVLSGR
DSPILRRRIADLGIKLYFLGKLEKETACFELMKQAGVTAEQTAYIGDDSVDLPAFAACGT
SFTVADAPIYVKNTVDHVLSTNGGKGAFREMSDMILQAQGKSSVFDSAQGFLKSVKNMGQ
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



