Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.1: Epoxide Hydrolase Phosphatase Like
⌊ FunctionalDomain C1.5.1: Epoxide Hydrolase Phosphatase Like (ID 114943)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Shigella flexneri Taxon ID: 623 | 499906541 | WP_011587275.1 (RefSeq) | URP |
| Shigella flexneri 5 str. 8401 Taxon ID: 373384 | 110616977 | ABF05644.1 (Genbank) | URP |
| obsolete GI = 110807429 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | Q0SZ71 | Q0SZ71_SHIF8 (TrEMBL) |
Length of Enzyme (full-length): 199 | Length of Functional Domain: 199
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVSQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



