Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 107433)
No Notes.
Superfamily Assignment Evidence Code(s) | ISS |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia coli str. K-12 substr. MG1655 Taxon ID: 511145 | 148211 | AAA67608.1 (Genbank) | URP |
Uniprot
Protein Name | Accession | EC Number
![]() |
Identifier |
---|---|---|---|
5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB {ECO:0000303|PubMed:24123841} | P0ADP0 | YIGB_ECOLI (Swiss-Prot) |
Length of Enzyme (full-length): 238 | Length of Functional Domain: 231
MRFYRPLGRISAVTFDLDDTLYDNRPVILRTEREALTFVQNYHPALRSFQNEDLQRLRQA
VREAEPEIYHDVTRWXFRSIEQAMLDAGLSAEEASAGAHAAMINFAKWRSRIDVPQQTHD
TLKQLAKKWPLVAITNGNAQPELFGLGDYFEFVLRAGPHGRSKPFSDMYFLAAEKLNVPI
XEILHVGDDLTTDVGGAIRSGMQACWIRPENGDLMQTWDSRLLPHLEISRLASLTSLI
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.