Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.5: HAD, Beta-PGM, Phosphatase Like
⌊ C1.5.6: HAD, Beta-PGM, Phosphatase Like
⌊ FunctionalDomain C1.5.6: HAD, Beta-PGM, Phosphatase Like (ID 107228)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Mus musculus Taxon ID: 10090 | 13385586 | NP_080362.1 (RefSeq) | PRP URP |
| Mus musculus Taxon ID: 10090 | 148696647 | EDL28594.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 52789357 | AAH83086.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 17391250 | AAH18527.1 (Genbank) | PRP URP |
| Mus musculus Taxon ID: 10090 | 30315945 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 12862208 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 12838210 | PRP URP | |
| obsolete GI = 123230314 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| N-acylneuraminate-9-phosphatase | Q9CPT3 | 3.1.3.29 | NANP_MOUSE (Swiss-Prot) |
Length of Enzyme (full-length): 248 | Length of Functional Domain: 238
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKEC
FHPYSTCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTE
LRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQ
PGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSI
DCKVSMSV
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



