Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup mandelate racemase

     ⌊ Family xylonate dehydratase 2

  ⌊ FunctionalDomain xylonate dehydratase 2 (ID 92423)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code IES PubMed:19584053
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Haloferax volcanii Taxon ID: 2246 490140767 WP_004041116.1 (RefSeq)
Haloferax volcanii DS2 Taxon ID: 309800 292493977 YP_003533119.1 (RefSeq) URP
Haloferax volcanii DS2 Taxon ID: 309800 445582452 ELY36793.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
D-xylonate dehydratase D4GP40 4.2.1.82 XAD_HALVD (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 412 | Length of Functional Domain: 412

1       10        20        30        40        50        60

MVEQAKLSDPNAEYTMRDLSAETIDITNPRGGVRDAEITDVQTTMVDGNYPWILVRVYTD
AGVVGTGEAYWGGGDTAIIERMKPFLVGENPLDIDRLYEHLVQKMSGEGSVSGKVISAIS
GIEIALHDVAGKLLDVPAYQLVGGKYRDEVRVYCDLHTEDEANPQACAEEGVRVVEELGY
DAIKFDLDVPSGHEKDRANRHLRNPEIDHKVEIVEAVTEAVGDRADVAFDCHWSFTGGSA
KRLASELEDYDVWWLEDPVPPENHDVQKLVTQSTTTPIAVGENVYRKFGQRTLLEPQAVD
IIAPDLPRVGGMRETRKIADLADMYYIPVAMHNVSSPIGTMASAQVAAAIPNSLALEYHS
YQLGWWEDLVEEDDLIQNGHMEIPEKPGLGLTLDLDAVEAHMVEGETLFDEE
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
230 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
256 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
282 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 5/5 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
230 Asp (D) side chain metal binding ligand metal ligand -- binding ICS
256 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
282 Glu (E) side chain metal binding ligand metal ligand -- binding ICS
305 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator IDA
332 His (H) side chain proton abstraction (general base) proton relay -- reactant IDA
Family CAR This EFD conserves 7/7 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
230 Asp (D) side chain Metal binding ligand metal ligand -- binding ISS PubMed:19584053
232 His (H) side chain General Acid proton relay -- reactant ISS PubMed:19584053
256 Glu (E) side chain Metal binding ligand metal ligand -- binding ISS PubMed:19584053
282 Glu (E) side chain Metal binding ligand metal ligand -- binding ISS PubMed:19584053
305 Asp (D) side chain Controls pKa of His base activation -- spectator ISS PubMed:19584053
332 His (H) side chain abstracts alpha proton (base) proton relay -- reactant ISS PubMed:19584053
357 Glu (E) side chain Stabilizes transition state electrostatic stabiliser -- spectator ISS PubMed:19584053

Catalyzed Reaction

xylonate dehydratase

+
D-xylonate
17746		 2-dehydro-3-deoxy-D-arabinonic acid
1060		 water
15377

EC: 4.2.1.82 | IntEnz: 4.2.1.82 | Kegg: 4.2.1.82 | BioCyc: 4.2.1.82 | BRENDA: 4.2.1.82

Curation History
Time Change Annotation Old Value New Value
Aug. 1, 2014, 3:17 a.m. update curation agent updateSuperfamily.py setDomainBoundaries.py
July 9, 2015, 3:39 a.m. update curation agent setDomainBoundaries.py sbrown
update curation agent sbrown setDomainBoundaries.py
update name uncharacterized mandelate racemase subgroup sequence xylonate dehydratase 2
update superfamily assignment evidence code IEA ISS
Sept. 14, 2015, 3:44 a.m. update domain end position 406 412
update domain start position 15 1
EC number assigned by UniProtKB accession ID.