Top Level Name

  ⌊ Superfamily (core) Enolase

    ⌊ Subgroup glucarate dehydratase

  ⌊ FunctionalDomain uncharacterized glucarate dehydratase subgroup sequence, enolase superfamily (ID 65)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onNov. 21, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Salmonella enterica subsp. enterica serovar Typhi str. CT18 Taxon ID: 220341 16761740 NP_457357.1 (RefSeq)
Salmonella enterica Taxon ID: 28901 446133954 WP_000211809.1 (RefSeq) URP
Salmonella enterica subsp. enterica serovar Typhi str. STH2370 Taxon ID: 1443995 576305820 ETZ14524.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q8Z442 Q8Z442_SALTI (TrEMBL)

Sequence

Length of Enzyme (full-length): 446 | Length of Functional Domain: 445

1       10        20        30        40        50        60

MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGVGETPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLQGQALNVPVCELLGPGKQRDAVTVLGYLFYIGDRTKTDLPYLESTPGSHEWYRLRHQE
ALNSDAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAIALCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLTGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGK
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVRKAHDAYKKLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGR
H
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
234 Asp (D) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
259 Glu (E) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
288 Asn (N) side chain metal binding ligand metal ligand -- binding ISS PubMed:8987982
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
206 Lys (K) side chain abstracts alpha proton from l-stereochemistry substrates proton relay -- reactant ISS PubMed:10769114
234 Asp (D) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
259 Glu (E) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
288 Asn (N) side chain metal binding ligand metal ligand -- binding ICS PubMed:10769114
312 Asp (D) side chain controls pKa of catalytic His perturbates pKa -- spectator ISS PubMed:10769114
338 His (H) side chain abstracts alpha proton from d-stereochemistry substates proton relay -- reactant ISS PubMed:10769114

Structures

PDB ID Title Molecule Name Number of
EFDs
Resolution (Å) Mutant? Het group Links
4IL0 Crystal Structure Of Glucdrp From E. Coli K-12 Mg1655 (Efi Target Efi-506058) Glucarate Dehydratase-Related Protein 409 2.8 Citric Acid • Glycerol CSA • PDB • PDBSum
4GYP Crystal Structure Of The Heterotetrameric Complex Of Glucd And Glucdrp From E. Coli K-12 Mg1655 Glucarate Dehydratase • Glucarate Dehydratase-Related Protein 791 2.1 Magnesium Ion
(5 more ⇓)
CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Identical Sequences with Suspect Annotations in Other Databases (Schnoes et.al. 2009)

Genbank

Source DB Accession Species Source Annotation Misannot. Evid. Code Source Date
KEGG stt:t2870 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ygcY; probable glucarate dehydratase 2 [EC:4.2.1.40] [KO:K01706] BTC Feb. 17, 2006
KEGG sty:STY3099 Salmonella enterica subsp. enterica serovar Typhi str. CT18 ygcY; probable glucarate dehydratase 2 [EC:4.2.1.40] [KO:K01706] BTC Feb. 17, 2006
TrEMBL Q8Z442_SALTI Salmonella typhi Probable glucarate dehydratase 2 (EC 4.2.1.40) BTC Feb. 17, 2006

Curation History

Time Change Annotation Old Value New Value
April 30, 2014, 2:26 a.m. update curation agent sbrown setDomainBoundaries.py
update domain start position 3 1
EC number assigned by UniProtKB accession ID.