Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.15

  ⌊ FunctionalDomain cytGST-like protein (ID 59737)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onOct. 14, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 28105 501015024 WP_012067730.1 (RefSeq)
Sinorhizobium medicae WSM419 Taxon ID: 366394 150398719 YP_001329186.1 (RefSeq) URP
Sinorhizobium medicae WSM419 Taxon ID: 366394 150030234 ABR62351.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A6UFC1 A6UFC1_SINMW (TrEMBL)

Sequence

Length of Enzyme (full-length): 230 | Length of Functional Domain: 230

1       10        20        30        40        50        60

MPTLYHHPMSPASRFVRLILSEYGYQTELSEEQPWENRRDFLTLNPAGTLPVYVDDSMRA
LCGATIISEYLDETSGIMKRDRRLLAEDPFQRAEIRRLAEWFLHKMEADVTRPLVRERIF
KLQMTPDQGGGAPDSKVLRTSRSNIRQHMKYLSWLAGSRPWLAGDRISYADLAAAAAISV
LDYLGEIDWADAPAAKEWYQRLKSRPSFRPLLAERVRGVTPVSHYADLDF
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4MDC Crystal Structure Of Glutathione S-Transferase From Sinorhizobium Meliloti 1021, Nysgrc Target 021389 Putative Glutathione S-Transferase 3 1.78 Selenomethionine • Glycerol CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:38 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 230 205
update domain start position 1 2
Aug. 16, 2016, 8:32 a.m. update domain end position 205 230
update domain start position 2 1
EC number assigned by UniProtKB accession ID.