Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.20

  ⌊ FunctionalDomain cytGST-like protein (ID 59128)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Leptospira interrogans serovar Lai str. 56601 Taxon ID: 189518 24215323 NP_712804.1 (RefSeq) PRP URP
Leptospira interrogans Taxon ID: 173 446515982 WP_000593328.1 (RefSeq) URP
Leptospira interrogans serovar Linhai str. 56609 Taxon ID: 1395589 764084864 AJR14086.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a M6GFA5 M6GFA5_LEPIR (TrEMBL)
n/a M3FQG1 M3FQG1_LEPIR (TrEMBL)
n/a A0A0F6IF10 A0A0F6IF10_LEPIR (TrEMBL)
Show All

Sequence

Length of Enzyme (full-length): 218 | Length of Functional Domain: 218

1       10        20        30        40        50        60

MIKLHGASISNYVNKVKLGILEKGLEYEQIRIAPSQEEDFLKISPMGKIPVLEMDGKFIF
ESGAILEFLDTIFPQTPKLIPEDPWEAARVREISTIIETYLDIPARRIYLPAAKVSPEIV
EEVHSTLVKGIKALQRVVRFSPYIAGNVFTLADCSGFAHLSVLDEELRPFYPNNHPLDLL
NGWKEYFVFMKTKAGPALVEKDKQILKKILARAKTKIG
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3UBL Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans With Gsh Bound Glutathione Transferase 2 2.0 Glutathione
(4 more ⇓) 		CSA • PDB • PDBSum
3UBK Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Glutathione Transferase 2 1.95 Sulfate Ion
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.