Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.9

  ⌊ FunctionalDomain Cytosolic GST-like protein (ID 58330)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank: obsolete GIs = 68347294, 70732995

Sequence

Length of Enzyme (full-length): 204 | Length of Functional Domain: 204

1       10        20        30        40        50        60

MTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDN
GQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAP
EKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQD
HPQLAAWYFEISQRPSMLATRPPV
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4IBP Crystal Structure Of A Glutathione Transferase Family Member From Pseudomonas Fluorescens Pf-5, Target Efi-900011, With Bound Glutathione Glutathione S-Transferase-Like Protein Yibf 2 1.8 Selenomethionine
(2 more ⇓) 		CSA • PDB • PDBSum
4ID0 Crystal Structure Of A Glutathione Transferase Family Member From Pseudomonas Fluorescens Pf-5, Target Efi-900011, With Bound Glutathione Sulfinic Acid (Gso2H) And Acetate Glutathione S-Transferase-Like Protein Yibf 2 1.1 Selenomethionine
(3 more ⇓) 		CSA • PDB • PDBSum
4IJI Crystal Structure Of A Glutathione Transferase Family Member From Psuedomonas Fluorescens Pf-5, Target Efi-900011, With Bound S-(Propanoic Acid)-Glutathione Glutathione S-Transferase-Like Protein Yibf 2 1.5 Selenomethionine
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:44 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 204 194
Aug. 16, 2016, 8:39 a.m. update domain end position 194 204
EC number assigned by UniProtKB accession ID.