Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.10

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to chloride channel ("CLIC") proteins (ID 57825)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onOct. 14, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Rattus norvegicus Taxon ID: 10116 57526993 NP_001009651.1 (RefSeq) PRP URP
Rattus norvegicus Taxon ID: 10116 149029394 EDL84654.1 (Genbank) PRP URP
Rattus norvegicus Taxon ID: 10116 56789466 AAH88182.1 (Genbank) PRP URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Chloride intracellular channel protein 2 Q5M883 CLIC2_RAT (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 245 | Length of Functional Domain: 239

1       10        20        30        40        50        60

MASLALNTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTARKPEE
LKDLAPGTNPPFLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTYA
SVAKQ
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2PER Crystal Structure Of Human Chloride Intracellular Channel Protein 2 Chloride Intracellular Channel Protein 2 25 2.0 5-Mercapto-2-Nitro-Benzoic Acid CSA • PDB • PDBSum
2R5G Structure Of Human Clic2, Crystal Form B Chloride Intracellular Channel Protein 2 25 1.86 CSA • PDB • PDBSum
2R4V Structure Of Human Clic2, Crystal Form A Chloride Intracellular Channel Protein 2 25 1.85 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:43 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 245 222
update domain start position 1 15
Aug. 16, 2016, 8:37 a.m. update domain end position 222 245
update domain start position 15 7
EC number assigned by UniProtKB accession ID.