Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.25

  ⌊ FunctionalDomain cytGST-like protein (ID 57439)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onOct. 14, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Agrobacterium tumefaciens str. C58 Taxon ID: 176299 15891246 NP_356918.1 (RefSeq) URP
Taxon ID: 1183400 499279638 WP_010973264.1 (RefSeq)
Agrobacterium tumefaciens Taxon ID: 358 796556851 KJX86495.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A083ZGC1 A0A083ZGC1_RHIRD (TrEMBL)
n/a A9CFJ9 A9CFJ9_AGRFC (TrEMBL)

Sequence

Length of Enzyme (full-length): 230 | Length of Functional Domain: 217

1       10        20        30        40        50        60

MSNIETVPASIEMKPNPTITVFERSPDGGRGLARDMPVRWALEEVGQPYHVRRLSFEAMK
EASHLAYQPFGQIPSYEQGDLILFESGAIVMHIAQHHSGLLPEDQLRRARTVAWMFAALN
TIEPSILNFTTVWLFERNEPWHEARLARTKEQLLKRLDELSAWLGDREWLEGSFSAADIL
MICVLRRLESSGILKDYGNLLAYVERGKARPAFKRAFDAQLAVFTAASKN
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
2YCD Structure Of A Novel Glutathione Transferase From Agrobacterium Tumefaciens. Glutathione S-Transferase 3 1.4 S-(P-Nitrobenzyl)Glutathione • Phosphate Ion CSA • PDB • PDBSum
3LQ7 Crystal Structure Of Glutathione S-Transferase From Agrobacterium Tumefaciens Str. C58 Glutathione S-Transferase 3 2.3 CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:43 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 230 216
update domain start position 1 29
Aug. 16, 2016, 8:37 a.m. update domain end position 216 230
update domain start position 29 14
EC number assigned by UniProtKB accession ID.