Top Level Name
⌊ Superfamily (core) Glutathione Transferase (cytosolic)
⌊ Subgroup Main (cytGST)
⌊ Main.25
⌊ FunctionalDomain cytGST-like protein (ID 57439)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Oct. 14, 2016 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Agrobacterium tumefaciens str. C58 Taxon ID: 176299 | 15891246 | NP_356918.1 (RefSeq) | URP |
| Taxon ID: 1183400 | 499279638 | WP_010973264.1 (RefSeq) | |
| Agrobacterium tumefaciens Taxon ID: 358 | 796556851 | KJX86495.1 (Genbank) | URP |
| Agrobacterium tumefaciens Taxon ID: 358 | 666382424 | KEY52100.1 (Genbank) | URP |
| Agrobacterium tumefaciens str. C58 Taxon ID: 176299 | 15159613 | AAK89703.1 (Genbank) | URP |
| Agrobacterium tumefaciens Taxon ID: 358 | 381352867 | URP | |
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A083ZGC1 | A0A083ZGC1_RHIRD (TrEMBL) | |
| n/a | A9CFJ9 | A9CFJ9_AGRFC (TrEMBL) |
Length of Enzyme (full-length): 230 | Length of Functional Domain: 217
MSNIETVPASIEMKPNPTITVFERSPDGGRGLARDMPVRWALEEVGQPYHVRRLSFEAMK
EASHLAYQPFGQIPSYEQGDLILFESGAIVMHIAQHHSGLLPEDQLRRARTVAWMFAALN
TIEPSILNFTTVWLFERNEPWHEARLARTKEQLLKRLDELSAWLGDREWLEGSFSAADIL
MICVLRRLESSGILKDYGNLLAYVERGKARPAFKRAFDAQLAVFTAASKN
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



