Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  Main.3: Omega- and Tau-like

  ⌊ FunctionalDomain Cytosolic GST-like protein, similar to Omega and Tau class GSTs (ID 56989)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Drosophila melanogaster Taxon ID: 7227 21355775 NP_648235.1 (RefSeq) PRP URP
synthetic construct Taxon ID: 32630 220960194 ACL92633.1 (Genbank)
synthetic construct Taxon ID: 32630 220958330 ACL91708.1 (Genbank)
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Pyrimidodiazepine synthase {ECO:0000305} Q9VSL3 SEPIA_DROME (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 243 | Length of Functional Domain: 219

1       10        20        30        40        50        60

MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEW
LLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIER
FRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLEL
LKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNY
NLLV
KDA
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Curation History

Time Change Annotation Old Value New Value
May 3, 2014, 6:42 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 243 209
update domain start position 1 22
Aug. 16, 2016, 8:36 a.m. update domain end position 209 237
update domain start position 22 18
Oct. 13, 2016, 10:36 a.m. update domain end position 237 236
EC number assigned by UniProtKB accession ID.