Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Main (cytGST)

  ⌊ Main.19

  ⌊ FunctionalDomain cytGST-like protein (ID 56227)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onMarch 11, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Taxon ID: 136843 499373298 WP_011060876.1 (RefSeq)
Pseudomonas fluorescens CHA0 Taxon ID: 1124983 500242258 AGL84416.1 (Genbank) URP
Pseudomonas fluorescens Pf-5 Taxon ID: 220664 68344247 AAY91853.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a Q4KDJ6 Q4KDJ6_PSEF5 (TrEMBL)

Sequence

Length of Enzyme (full-length): 203 | Length of Functional Domain: 203

1       10        20        30        40        50        60

MKLIGMLDSPYVRRVAISLKSLGLPFEHHSLSVFSTFEQFKAINPVVKAPTLVCEGGEVL
MDSSLIIDYLETLAGPQRSLMPTALPQRLRELRLVGLALAACEKSVQIVYERNLRPAEKQ
HGPWLERVGGQLQAAYGELEQELQKQPLPRDGSLGQAGISLAVAWSFSQMMVADQFNPGQ
FPAVRGFAEYAEQLPVFLATPAT
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
3LXT Crystal Structure Of Glutathione S Transferase From Pseudomonas Fluorescens Glutathione S Transferase 2 1.76 Glycerol • Chloride Ion CSA • PDB • PDBSum
3M0F Crystal Structure Of Glutathione S Transferase In Complex With Glutathione From Pseudomonas Fluorescens Uncharacterized Protein Gst_N 2 1.6 Glutathione CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.
EC number assigned by UniProtKB accession ID.