Top Level Name

  ⌊ Superfamily (core) Glutathione Transferase (cytosolic)

    ⌊ Subgroup Xi (cytGST)

  ⌊ Xi.1

  ⌊ FunctionalDomain similar to Xi class cytGSTs (ID 55984)

Superfamily Assignment Evidence Code(s) ISS
This entry was last updated onOct. 14, 2016

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Saccharomyces cerevisiae S288c Taxon ID: 559292 398365369 NP_013002.3 (RefSeq) PRP URP
Saccharomyces cerevisiae YJM1549 Taxon ID: 1294384 767185222 AJS55926.1 (Genbank) URP
Saccharomyces cerevisiae YJM1592 Taxon ID: 1294387 767183607 AJS56826.1 (Genbank) URP
Show All

Uniprot

Protein NameAccessionEC Number Identifier
Glutathione S-transferase omega-like 2 P36156 2.5.1.18 GTO2_YEAST (Swiss-Prot)

Sequence

Length of Enzyme (full-length): 370 | Length of Functional Domain: 259

1       10        20        30        40        50        60

MSKQWASGTNGAFKRQVSSFRETISKQHPIYKPAKGRYWLYVSLACPWAHRTLITRALKG
LTSVIGCSVVHWHLDEKGWRFLDMEKQLEDSEDFLEHWHDVAGGIRTAKEDSSKSFAEIK
NDSQRFMVDATNEPHYGYKRISDLYYKSDPQYSARFTVPVLWDLETQTIVNNESSEIIRI
LNSSAFDEFVDDDHKKTDLVPAQLKTQIDDFNSWVYDSINNGVYKTGFAEKAEVYESEVN
NVFEHLDKVEKILSDKYSKLKAKYGEEDRQKILGEFFTVGDQLTEADIRLYTTVIRFDPV
YVQHFKCNFTSIRAGYPFIHLWVRNLYWNYDAFRYTTDFDHIKLHYTRSHTRINPLGITP
LGPKPDIRPL
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 0/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
227 Gly (G) side chain MISMATCH: This residue does not match the specified amino acid type of Y, and thus may not function in the same manner as other sequences in the subgroup
304 His (H) side chain MISMATCH: This residue does not match the specified amino acid type of Y, and thus may not function in the same manner as other sequences in the subgroup
349 Ser (S) side chain MISMATCH: This residue does not match the specified amino acid type of Y, and thus may not function in the same manner as other sequences in the subgroup

Curation History
Time Change Annotation Old Value New Value
May 3, 2014, 6:40 a.m. update curation agent smashiya setDomainBoundaries.py
update domain end position 370 332
update domain start position 1 154
Aug. 16, 2016, 8:33 a.m. update domain end position 332 369
update domain start position 154 110
Oct. 13, 2016, 10:33 a.m. update domain start position 110 111
EC number assigned by UniProtKB accession ID.