Top Level Name
⌊ Superfamily (core) Enolase
⌊ Subgroup mandelate racemase
⌊ FunctionalDomain Uncharacterized Mandelate racemase subgroup sequence (ID 54244)
No Notes.
| Superfamily Assignment Evidence Code(s) | ISS |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 Taxon ID: 667127 | 259039322 | EEW40464.1 (Genbank) | URP |
| obsolete GIs = 262043298, 490242626 | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | C8T753 | C8T753_KLEPR (TrEMBL) |
Length of Enzyme (full-length): 182 | Length of Functional Domain: 182
MLDCWMSQDVNYATKLAHACAPYNLKWIEECLPPQQYEGYRELKRQAPAGMMVTSGEHHG
TLQSFRTLSETGIDIMQPDVGWCGGLTTLVEIAAIAKARGQLVVPHGSSVYSHHAVITFT
NTPFSEFLMTSPDCATLRPQFDPILLGEPVPESGRIHKSVLDKPGFGVELNRDCNLKRPY
QH
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



