Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.3: Acid Phosphatase Like
⌊ FunctionalDomain uncharacterized C1.3: Acid Phosphatase Like subgroup sequence (ID 476884)
No Notes.
Superfamily Assignment Evidence Code(s) | IEA |
This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
Species | GI | Accession | Proteome |
---|---|---|---|
Escherichia coli Taxon ID: 562 | 485730076 | WP_001358029.1 (RefSeq) | URP |
Escherichia coli UMEA 3152-1 Taxon ID: 1281195 | 535560415 | EQW98185.1 (Genbank) | URP |
Escherichia coli WV_060327 Taxon ID: 945433 | 320193423 | EFW68060.1 (Genbank) | URP |
obsolete GI = 416338811 |
Length of Enzyme (full-length): 237 | Length of Functional Domain: 237
MRKITQALSAVCLLFALNSSAVALASSPSPLNPGTNVAKLAEQVPIHWVSVAQIENSLAG
RPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVAR
QLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQW
LQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.