Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ FunctionalDomain uncharacterized haloacid dehalogenase superfamily sequence (ID 474546)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Feb. 13, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Mus musculus Taxon ID: 10090 | 512125805 | PRP URP | |
| Mus musculus Taxon ID: 10090 | 402550485 | PRP URP |
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| Cytosolic 5'-nucleotidase 3A {ECO:0000305|PubMed:16672222} | Q9D020 | 5NT3A_MOUSE (Swiss-Prot) |
Length of Enzyme (full-length): 297 | Length of Functional Domain: 292
1 10 20 30 40 50 60
MTNQESAVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYN
GKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGL
LIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGV
YHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQ
GDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
This shows the full-length sequence of the enzyme.
The
region of the functional domain is highlighted in black letters,
while the
residual residues are shown in grey.
The Superfamily domain, when present, is
shown using underlining.
In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.



