Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.3: Acid Phosphatase Like
⌊ FunctionalDomain uncharacterized C1.3: Acid Phosphatase Like subgroup sequence (ID 472475)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Escherichia coli Taxon ID: 562 | 485764357 | WP_001389200.1 (RefSeq) | URP |
| Escherichia coli Taxon ID: 562 | 748019120 | KIG31240.1 (Genbank) | URP |
| Escherichia coli FAP1 Taxon ID: 1412834 | 695936616 | AIT32847.1 (Genbank) | URP |
| Escherichia coli 2-177-06_S3_C1 Taxon ID: 1444121 | 651733459 | KDW12322.1 (Genbank) | URP |
| Escherichia coli HVH 115 (4-4465989) Taxon ID: 1281052 | 534958898 | EQR07584.1 (Genbank) | URP |
| Escherichia coli HVH 115 (4-4465997) Taxon ID: 1281051 | 534948753 | EQQ97626.1 (Genbank) | URP |
| Escherichia coli O08 Taxon ID: 1227814 | 449313064 | EMD03294.1 (Genbank) | URP |
| Escherichia coli H494 Taxon ID: 656405 | 371596944 | EHN85770.1 (Genbank) | URP |
| obsolete GIs = 450229421, 422958036 | |||
| Show All | |||
Uniprot
| Protein Name | Accession | EC Number
![]() |
Identifier |
|---|---|---|---|
| n/a | A0A1X3KVA8 | A0A1X3KVA8_ECOLX (TrEMBL) |
Length of Enzyme (full-length): 237 | Length of Functional Domain: 237
MRKITQAISAVCLLFALNSSAVALASSPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAG
RPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVAR
QLIDMHVRRGDAIFFVTGRSPMKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQW
LQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



