Top Level Name
⌊ Superfamily (core) Haloacid Dehalogenase
⌊ Subgroup C1.1: Acid Phosphatase Like
⌊ FunctionalDomain uncharacterized C1.1: Acid Phosphatase Like subgroup sequence (ID 470347)
No Notes.
| Superfamily Assignment Evidence Code(s) | IEA |
| This entry was last updated on | Nov. 22, 2017 |
References to Other Databases
Genbank
| Species | GI | Accession | Proteome |
|---|---|---|---|
| Haemophilus haemolyticus Taxon ID: 726 | 491840699 | WP_005627157.1 (RefSeq) | URP |
| Haemophilus haemolyticus M19107 Taxon ID: 1028802 | 341952797 | EGT79315.1 (Genbank) | URP |
| obsolete GI = 417839451 | |||
Length of Enzyme (full-length): 274 | Length of Functional Domain: 232
MKTTLKMTALAALSALVLSGCGAHKMKSEEHANMQLQQQAVLGLNWMQDSGEYKALAYQA
YNAAKVAFDHAKVAKGKKKAVVVDLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQS
RAVPGAVEFNNYVNSHKGKMFYVTNRKDSSEKAGTIDDMKRLGFNGVEESAFYLKKDKSA
KAARFAEIEKQGYEIVLYVGDNLDDFGDTVYGKLNADRRAFVDQNQGKFGKTFIMLPNAN
YGGWEGGLADGYFKKDTQGKIKARLDAIQAWDGK
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.



