Top Level Name

  ⌊ Superfamily (core) Isoprenoid Synthase Type II

    ⌊ Subgroup Prenyltransferase Like 2

  ⌊ FunctionalDomain uncharacterized Prenyltransferase Like 2 subgroup sequence, Isoprenoid Synthase Type II superfamily (ID 447530)

Superfamily Assignment Evidence Code(s) IEA
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Papio anubis Taxon ID: 9555 402862095 XP_003895405.1 (RefSeq) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a A0A096NI91 A0A096NI91_PAPAN (TrEMBL)

Sequence

Length of Enzyme (full-length): 732 | Length of Functional Domain: 729

1       10        20        30        40        50        60

MTEGTCLRRRGGPYKTEPATDLGRWRLSCERGRQTWTYLQDERAGREQTGLEAHALGLDT
KNYFKDLPKAHTACEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLP
AGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNIL
HKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPM
SYCYAIRLSATEDPLVQSLRQELYVEDFASIDWPAQRNNVAPDELYTPHSWLLHVVYALL
NLYERHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAFQE
HVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVADCTAEALKAVLLLQEKCPFVTEHIPR
ERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQA
LKYFHKHFPDHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG
QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWALMGLM
AVRHPDIEAQERGIRCLLEKQLPNGDWPQENISGVFNKSCAISYTSYRNVFPIWALGRFS
QLYPERALAGRP
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues

Subgroup CAR This EFD conserves 4/4 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
387 Trp (W) side chain stabilizes intermediate electrostatic stabiliser -- spectator ICS PubMed:9931258
444 Phe (F) side chain stabilizes intermediate electrostatic stabiliser -- spectator ICS PubMed:9931258
455 Asp (D) side chain initiates catalyzed reaction via protonation of substrate activation -- spectator ICS PubMed:9931258
581 Trp (W) side chain stabilizes intermediate electrostatic stabiliser -- spectator ICS PubMed:9931258

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
1W6K Structure Of Human Osc In Complex With Lanosterol Lanosterol Synthase 32 2.1 B-Octylglucoside • Lanosterol CSA • PDB • PDBSum
1W6J Structure Of Human Osc In Complex With Ro 48-8071 Lanosterol Synthase 32 2.2 B-Octylglucoside
(2 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
May 2, 2014, 3:01 a.m. update curation agent sbrown setDomainBoundaries.py
update domain end position 732 729
update domain start position 6 1
EC number assigned by UniProtKB accession ID.