Top Level Name

  ⌊ Superfamily (core) Radical SAM

    ⌊ Subgroup SPASM/twitch domain containing

  ⌊ main SPASM domain-containing

  ⌊ dehydrogenase like

     ⌊ Family anaerobic Cys-type sulfatase-maturating enzyme

  ⌊ FunctionalDomain anaerobic Cys-type sulfatase-maturing enzyme protein (ID 436109)

Superfamily Assignment Evidence Code(s) ISS
Family Assignment Evidence Code ISS
This entry was last updated onJune 10, 2017

References to Other Databases

Genbank

SpeciesGIAccessionProteome
Clostridium perfringens Taxon ID: 1502 490595386 WP_004460406.1 (RefSeq) URP
Clostridium perfringens D str. JGS1721 Taxon ID: 488537 177908985 EDT71467.1 (Genbank) URP

Uniprot

Protein NameAccessionEC Number Identifier
n/a B1V3Y9 B1V3Y9_CLOPF (TrEMBL)

Sequence

Length of Enzyme (full-length): 370 | Length of Functional Domain: 370

1       10        20        30        40        50        60

MPPLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLEIMVKRVLNEADGHCS
FAFQGGEPTLAGLEFFERLMELQRKHNYKNLKIYNSLQTNGTLIDESWAKFLSENKFLVG
LSMDGPKEIHNLNRKDCFGLDTFSKVERAAELFKKYNVEFNILCVVTSNTARHVNKVYKY
FKEKDFKFLQFINCLDPLYEEKGKYNYSLKPKDYTKFLKNLFDFWYEDFLNGNRVSIRYF
DGLLETILLGKSSSCGMNGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFET
NKNHEFIKSSFKVHEECKKCKWFRLCKGGCRRCRDSKEDSALELNYYCQSYKEFFEYAFP
RLINVAKTIK
This shows the full-length sequence of the enzyme. The region of the functional domain is highlighted in black letters, while the residual residues are shown in grey. The Superfamily domain, when present, is shown using underlining. In many cases the functional domain is the full-length sequence.
Conserved catalytic residues (as determined by automated alignment to family, subgroup, or superfamily HMMs) are shown with teal highlighting . Conserved catalytic residues which do not matched the Conserved Alignment Residue are shown with maroon highlighting . Information regarding their function can be found in the Conserved Residues section below.
FASTA formatted full-length sequence.
BLAST this sequence against SFLD.
Scan SFLD-HMMs with this sequence.

Conserved Residues
Superfamily CAR This EFD conserves 3/3 Superfamily-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
Subgroup CAR This EFD conserves 6/6 Subgroup-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
320 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
326 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
348 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
Family CAR This EFD conserves 10/10 Family-specific Conserved Alignment Residues.
Position Amino Acid Location Function Role Evidence Code Reference
15 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
19 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
22 Cys (C) side chain Binds [4Fe-4S]-AdoMet cluster cofactor binding -- binding ISS
255 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
261 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
276 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
317 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
320 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
326 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS
330 Cys (C) side chain Binds [4Fe-4S] cluster cofactor binding -- binding ISS

Structures

PDB ID Title Molecule Name Number of
EFDs		 Resolution (Å) Mutant? Het group Links
4K36 His6 Tagged Ansmecpe With Bound Adomet Anaerobic Sulfatase-Maturating Enzyme 10 1.62 Iron/Sulfur Cluster
(2 more ⇓) 		CSA • PDB • PDBSum
4K39 Native Ansmecpe With Bound Adomet And Cp18Cys Peptide Anaerobic Sulfatase-Maturating Enzyme • Cp18Cys Peptide 10 1.78 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4K38 Native Ansmecpe With Bound Adomet And Kp18Cys Peptide Anaerobic Sulfatase-Maturating Enzyme • Kp18Cys Peptide 10 1.83 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
4K37 Native Ansmecpe With Bound Adomet Anaerobic Sulfatase-Maturating Enzyme 10 1.62 Iron/Sulfur Cluster
(3 more ⇓) 		CSA • PDB • PDBSum
Percent identity and alignment length from the BLAST match of the Functional Domain sequence to the PDB sequence.
"Yes" indicates that a GI associated with this Functional Domain was mapped to the PDB ID via UniProtKB.

Curation History
Time Change Annotation Old Value New Value
Oct. 16, 2014, 7:12 a.m. update curation agent holliday setDomainBoundaries.py
Oct. 15, 2016, 7:09 a.m. update curation agent setDomainBoundaries.py holliday
update curation agent holliday setDomainBoundaries.py
update family assignment evidence code IEA ISS
update name Anaerobic Cys-type sulfatase-maturating enzyme anaerobic Cys-type sulfatase-maturing enzyme protein
update superfamily assignment evidence code IEA ISS
EC number assigned by UniProtKB accession ID.